Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonocarboxylate Transporter 1
LigandBDBM21986
Substrate/CompetitorBDBM21986
Meas. Tech.Radioligand Filter Binding Assay
pH7.8±n/a
Temperature295.15±n/a K
Ki 0.33±n/a nM
Citation Guile SDBantick JRCheshire DRCooper MEDavis AMDonald DKEvans REyssade CFerguson DDHill SHutchinson RIngall AHKingston LPMartin IMartin BPMohammed RTMurray CPerry MWReynolds RHThorne PVWilkinson DJWithnall J Potent blockers of the monocarboxylate transporter MCT1: novel immunomodulatory compounds. Bioorg Med Chem Lett 16:2260-5 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Monocarboxylate Transporter 1
Name:Monocarboxylate transporter 1
Synonyms:MCT 1 | Solute carrier family 16 member 1
Type:PROTEIN
Mol. Mass.:53956.64
Organism:Homo sapiens (Human)
Description:ChEMBL_1451367
Residue:500
Sequence:
MPPAVGGPVGYTPPDGGWGWAVVIGAFISIGFSYAFPKSITVFFKEIEGIFHATTSEVSW
ISSIMLAVMYGGGPISSILVNKYGSRIVMIVGGCLSGCGLIAASFCNTVQQLYVCIGVIG
GLGLAFNLNPALTMIGKYFYKRRPLANGLAMAGSPVFLCTLAPLNQVFFGIFGWRGSFLI
LGGLLLNCCVAGALMRPIGPKPTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQ
EKRSVFQTINQFLDLTLFTHRGFLLYLSGNVIMFFGLFAPLVFLSSYGKSQHYSSEKSAF
LLSILAFVDMVARPSMGLVANTKPIRPRIQYFFAASVVANGVCHMLAPLSTTYVGFCVYA
GFFGFAFGWLSSVLFETLMDLVGPQRFSSAVGLVTIVECCPVLLGPPLLGRLNDMYGDYK
YTYWACGVVLIISGIYLFIGMGINYRLLAKEQKANEQKKESKEEETSIDVAGKPNEVTKA
AESPDQKDTDGGPKEEESPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21986
BDBM21986
NameBDBM21986
Synonyms:5-[(3-hydroxypropyl)sulfanyl]-3-methyl-1-(2-methylpropyl)-6-(naphthalen-1-ylmethyl)-1H,2H,3H,4H,6H-pyrrolo[3,4-d]pyrimidine-2,4-dione | 5-[(3-hydroxypropyl)sulfanyl]-3-methyl-1-(2-methylpropyl)-6-(naphthalen-1-ylmethyl)-1H-pyrrolo[3,4-d]pyrimidine-2,4(3H,6H)-dione | CHEMBL85752 | Pyrrolo[3,4-d]pyrimidine-2,4(3H,6H)-dione, 1 | [3H]-pyrrolo[3,4-d]pyrimidine-2,4(3H,6H)-dione
Typen/a
Emp. Form.C25H29N3O3S
Mol. Mass.451.581
SMILESCC(C)Cn1c2cn(Cc3cccc4ccccc34)c(SCCCO)c2c(=O)n(C)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: