Reaction Details |
 | Report a problem with these data |
Target | Cathepsin B-Like Cysteine Protease (TbcatB) |
---|
Ligand | BDBM22099 |
---|
Substrate/Competitor | BDBM22047 |
---|
Meas. Tech. | Enzyme Inhibition Assay |
---|
Temperature | 298.15±n/a K |
---|
IC50 | 930±n/a nM |
---|
Comments | extracted |
---|
Citation | Mallari JP; Shelat AA; Obrien T; Caffrey CR; Kosinski A; Connelly M; Harbut M; Greenbaum D; McKerrow JH; Guy RK Development of potent purine-derived nitrile inhibitors of the trypanosomal protease TbcatB. J Med Chem 51:545-52 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Cathepsin B-Like Cysteine Protease (TbcatB) |
---|
Name: | Cathepsin B-Like Cysteine Protease (TbcatB) |
Synonyms: | CPC | Cysteine peptidase C | TbcatB |
Type: | Enzyme |
Mol. Mass.: | 37220.37 |
Organism: | Trypanosoma brucei |
Description: | Enzyme was expressed in yeast Pichia pastoris. |
Residue: | 340 |
Sequence: | MHLMRACITFCIASTAVVAVNAALVAEDAPVLSKAFVDRVNRLNRGIWKAKYDGVMQNIT
LREAKRLNGVIKKNNNASILPKRRFTEEEARAPLPSSFDSAEAWPNCPTIPQIADQSACG
SCWAVAAASAMSDRFCTMGGVQDVHISAGDLLACCSDCGDGCNGGDPDRAWAYFSSTGLV
SDYCQPYPFPHCSHHSKSKNGYPPCSQFNFDTPKCNYTCDDPTIPVVNYRSWTSYALQGE
DDYMRELFFRGPFEVAFDVYEDFIAYNSGVYHHVSGQYLGGHAVRLVGWGTSNGVPYWKI
ANSWNTEWGMDGYFLIRRGSSECGIEDGGSAGIPLAPNTA
|
|
|
BDBM22099 |
---|
BDBM22047 |
---|
Name | BDBM22099 |
Synonyms: | 6-{[(3,4-dichlorophenyl)methyl]amino}-9-(5-hydroxypentyl)-9H-purine-2-carbonitrile | Compound 3{12,4} |
Type | Small organic molecule |
Emp. Form. | C18H18Cl2N6O |
Mol. Mass. | 405.281 |
SMILES | OCCCCCn1cnc2c(NCc3ccc(Cl)c(Cl)c3)nc(nc12)C#N |
Structure |
|