Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFatty Acid Amide Hydrolase
LigandBDBM23029
Substrate/CompetitorBDBM23028
Meas. Tech.FAAH Inhibition Assay
pH9±n/a
Temperature295.15±n/a K
Ki 5.1±0.6 nM
IC50 40±n/a nM
Citation Hardouin CKelso MJRomero FARayl TJLeung DHwang ICravatt BFBoger DL Structure-activity relationships of alpha-ketooxazole inhibitors of fatty acid amide hydrolase. J Med Chem 50:3359-68 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Fatty Acid Amide Hydrolase
Name:DNA Ligase I
Synonyms:ATP-dependent DNA ligase | Polydeoxyribonucleotide synthase [ATP]
Type:Enzyme
Mol. Mass.:101721.76
Organism:Homo sapiens (Human)
Description:n/a
Residue:919
Sequence:
MQRSIMSFFHPKKEGKAKKPEKEASNSSRETEPPPKAALKEWNGVVSESDSPVKRPGRKA
ARVLGSEGEEEDEALSPAKGQKPALDCSQVSPPRPATSPENNASLSDTSPMDSSPSGIPK
RRTARKQLPKRTIQEVLEEQSEDEDREAKRKKEEEEEETPKESLTEAEVATEKEGEDGDQ
PTTPPKPLKTSKAETPTESVSEPEVATKQELQEEEEQTKPPRRAPKTLSSFFTPRKPAVK
KEVKEEEPGAPGKEGAAEGPLDPSGYNPAKNNYHPVEDACWKPGQKVPYLAVARTFEKIE
EVSARLRMVETLSNLLRSVVALSPPDLLPVLYLSLNHLGPPQQGLELGVGDGVLLKAVAQ
ATGRQLESVRAEAAEKGDVGLVAENSRSTQRLMLPPPPLTASGVFSKFRDIARLTGSAST
AKKIDIIKGLFVACRHSEARFIARSLSGRLRLGLAEQSVLAALSQAVSLTPPGQEFPPAM
VDAGKGKTAEARKTWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLERLPEHCKLSPGIPL
KPMLAHPTRGISEVLKRFEEAAFTCEYKYDGQRAQIHALEGGEVKIFSRNQEDNTGKYPD
IISRIPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAF
DLIYLNGESLVREPLSRRRQLLRENFVETEGEFVFATSLDTKDIEQIAEFLEQSVKDSCE
GLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLL
ASYDEDSEELQAICKLGTGFSDEELEEHHQSLKALVLPSPRPYVRIDGAVIPDHWLDPSA
VWEVKCADLSLSPIYPAARGLVDSDKGISLRFPRFIRVREDKQPEQATTSAQVACLYRKQ
SQIQNQQGEDSGSDPEDTY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM23029
BDBM23028
NameBDBM23029
Synonyms:1-[5-(pyridin-2-yl)-1,3-oxazol-2-yl]-7-(thiophen-3-yl)heptan-1-one | alpha-ketooxazole, 5b
TypeSmall organic molecule
Emp. Form.C19H20N2O2S
Mol. Mass.340.439
SMILESO=C(CCCCCCc1ccsc1)c1ncc(o1)-c1ccccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: