Reaction Details |
| Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Ligand | BDBM23331 |
---|
Substrate/Competitor | BDBM23318 |
---|
Meas. Tech. | Peptidyl Prolyl Isomerase (PPIase) Inibition Assay |
---|
pH | 8±n/a |
---|
Temperature | 273.15±n/a K |
---|
Ki | 3000±n/a nM |
---|
Km | 520000±80000 nM |
---|
kcat | 344±26 1/sec |
---|
Citation | Wu, YQ; Wilkinson, DE; Limburg, D; Li, JH; Sauer, H; Ross, D; Liang, S; Spicer, D; Valentine, H; Fuller, M; Guo, H; Howorth, P; Soni, R; Chen, Y; Steiner, JP; Hamilton, GS Synthesis of ketone analogues of prolyl and pipecolyl ester FKBP12 ligands. J Med Chem45:3558-68 (2002) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Name: | Peptidyl-prolyl cis-trans isomerase FKBP1A |
Synonyms: | 12 kDa FKBP | FK506-binding protein 1A | FKB1A_BOVIN | FKBP-12 | FKBP1 | FKBP1A | Immunophilin FKBP12 | PPIase | Rotamase |
Type: | Isomerase |
Mol. Mass.: | 11911.51 |
Organism: | Bos taurus (bovine) |
Description: | The enzyme was purified from calf thymus. The collected protein was further applied to Sephacryl column, and the fraction contained high PPIase activity was pooled. |
Residue: | 108 |
Sequence: | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFVLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPNATLIFDVELLKLE
|
|
|
BDBM23331 |
---|
BDBM23318 |
---|
Name | BDBM23331 |
Synonyms: | 3,3-dimethyl-1-[(2S)-2-(6-phenylhexanoyl)piperidin-1-yl]pentane-1,2-dione | Pipecolyl ketone, 11d |
Type | Small organic molecule |
Emp. Form. | C24H35NO3 |
Mol. Mass. | 385.5396 |
SMILES | CCC(C)(C)C(=O)C(=O)N1CCCC[C@H]1C(=O)CCCCCc1ccccc1 |r| |
Structure |
|