Reaction Details |
| Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Ligand | BDBM23353 |
---|
Substrate/Competitor | BDBM23318 |
---|
Meas. Tech. | Peptidyl Prolyl Isomerase (PPIase) Inibition Assay |
---|
pH | 8±n/a |
---|
Temperature | 288.15±n/a K |
---|
Ki | 123±n/a nM |
---|
Citation | Hudack, RA; Barta, NS; Guo, C; Deal, J; Dong, L; Fay, LK; Caprathe, B; Chatterjee, A; Vanderpool, D; Bigge, C; Showalter, R; Bender, S; Augelli-Szafran, CE; Lunney, E; Hou, X Design, synthesis, and biological activity of novel polycyclic aza-amide FKBP12 ligands. J Med Chem49:1202-6 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Name: | Peptidyl-prolyl cis-trans isomerase FKBP1A |
Synonyms: | 12 kDa FK506-binding protein | 12 kDa FKBP | FK506-binding protein 1A | FK506-binding protein 1A (FKBP12) | FKB1A_HUMAN | FKBP-12 | FKBP-1A | FKBP1 | FKBP12 | FKBP1A | Immunophilin FKBP12 | PPIase | PPIase FKBP1A | Peptidyl-prolyl cis-trans isomerase (FKBP) | Rotamase | RyR1/FKBP12 | mTOR/FKBP12A/FKBP12B |
Type: | Isomerase |
Mol. Mass.: | 11953.09 |
Organism: | Homo sapiens (Human) |
Description: | P62942 |
Residue: | 108 |
Sequence: | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
|
|
|
BDBM23353 |
---|
BDBM23318 |
---|
Name | BDBM23353 |
Synonyms: | 1-{4,6-dimethoxy-12-oxo-11,17-diazatetracyclo[11.3.1.0^{2,11}.0^{3,8}]heptadeca-3(8),4,6-trien-17-yl}-2-(4-ethylphenyl)ethane-1,2-dione | Tetracyclic aza-amide, 6i |
Type | Small organic molecule |
Emp. Form. | C27H30N2O5 |
Mol. Mass. | 462.5375 |
SMILES | CCc1ccc(cc1)C(=O)C(=O)N1C2CCCC1C(=O)N1CCc3cc(OC)cc(OC)c3C21 |TLB:10:12:14.15.16:20.33.18| |
Structure |
|