Reaction Details |
| Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Ligand | BDBM23386 |
---|
Substrate/Competitor | BDBM23318 |
---|
Meas. Tech. | Peptidyl Prolyl Isomerase (PPIase) Inibition Assay |
---|
Ki | 7000±n/a nM |
---|
Citation | Hudack, RA; Barta, NS; Guo, C; Deal, J; Dong, L; Fay, LK; Caprathe, B; Chatterjee, A; Vanderpool, D; Bigge, C; Showalter, R; Bender, S; Augelli-Szafran, CE; Lunney, E; Hou, X Design, synthesis, and biological activity of novel polycyclic aza-amide FKBP12 ligands. J Med Chem49:1202-6 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Name: | Peptidyl-prolyl cis-trans isomerase FKBP1A |
Synonyms: | 12 kDa FKBP | FK506-binding protein 1A | FKB1A_BOVIN | FKBP-12 | FKBP1 | FKBP1A | Immunophilin FKBP12 | PPIase | Rotamase |
Type: | Isomerase |
Mol. Mass.: | 11911.51 |
Organism: | Bos taurus (bovine) |
Description: | The enzyme was purified from calf thymus. The collected protein was further applied to Sephacryl column, and the fraction contained high PPIase activity was pooled. |
Residue: | 108 |
Sequence: | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFVLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPNATLIFDVELLKLE
|
|
|
BDBM23386 |
---|
BDBM23318 |
---|
Name | BDBM23386 |
Synonyms: | N-(2,4-difluorophenyl)-4,6-dimethoxy-12-oxo-11,17-diazatetracyclo[11.3.1.0^{2,11}.0^{3,8}]heptadeca-3(8),4,6-triene-17-carboxamide | Tetracyclic aza-amide, 13e |
Type | Small organic molecule |
Emp. Form. | C24H25F2N3O4 |
Mol. Mass. | 457.4698 |
SMILES | COc1cc2CCN3C(C4CCCC(N4C(=O)Nc4ccc(F)cc4F)C3=O)c2c(OC)c1 |TLB:15:14:10.11.12:7.8.26| |
Structure |
|