Reaction Details |
| Report a problem with these data |
Target | 3-oxoacyl-[acyl-carrier-protein] synthase 3 |
---|
Ligand | BDBM23575 |
---|
Substrate/Competitor | BDBM3158 |
---|
Meas. Tech. | FabD/FabH Coupled Assay |
---|
pH | 7±n/a |
---|
Temperature | 295.15±n/a K |
---|
IC50 | 8400±n/a nM |
---|
Citation | Nie, Z; Perretta, C; Lu, J; Su, Y; Margosiak, S; Gajiwala, KS; Cortez, J; Nikulin, V; Yager, KM; Appelt, K; Chu, S Structure-based design, synthesis, and study of potent inhibitors of beta-ketoacyl-acyl carrier protein synthase III as potential antimicrobial agents. J Med Chem48:1596-609 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
3-oxoacyl-[acyl-carrier-protein] synthase 3 |
---|
Name: | 3-oxoacyl-[acyl-carrier-protein] synthase 3 |
Synonyms: | 3-oxoacyl-[acyl-carrier-protein] synthase 3 | 3-oxoacyl-[acyl-carrier-protein] synthase III | Beta-ketoacyl-ACP synthase III | FABH_ENTFA | KAS III | beta-Ketoacyl-ACP Synthase III (FabH) | fabH |
Type: | Acyltransferase; homodimer |
Mol. Mass.: | 35176.53 |
Organism: | Enterococcus faecalis |
Description: | The E. faecalis FabH was cloned, and protein was expressed in E. coli. |
Residue: | 321 |
Sequence: | MKNYARISCTSRYVPENCVTNHQLSEMMDTSDEWIHSRTGISERRIVTQENTSDLCHQVA
KQLLEKSGKQASEIDFILVATVTPDFNMPSVACQVQGAIGATEAFAFDISAACSGFVYAL
SMAEKLVLSGRYQTGLVIGGETFSKMLDWTDRSTAVLFGDGAAGVLIEAAETPHFLNEKL
QADGQRWAALTSGYTINESPFYQGHKQASKTLQMEGRSIFDFAIKDVSQNILSLVTDETV
DYLLLHQANVRIIDKIARKTKISREKFLTNMDKYGNTSAASIPILLDEAVENGTLILGSQ
QRVVLTGFGGGLTWGSLLLTL
|
|
|
BDBM23575 |
---|
BDBM3158 |
---|
Name | BDBM23575 |
Synonyms: | 2-{[3-(diethylsulfamoyl)-4-fluorobenzene]amido}benzoic acid | Diethylsulfonamide Derivative, 13e |
Type | Small organic molecule |
Emp. Form. | C18H19FN2O5S |
Mol. Mass. | 394.417 |
SMILES | CCN(CC)S(=O)(=O)c1cc(ccc1F)C(=O)Nc1ccccc1C(O)=O |
Structure |
|