Reaction Details |
| Report a problem with these data |
Target | Matrilysin |
---|
Ligand | BDBM27878 |
---|
Substrate/Competitor | OmniMMP Substrate |
---|
Meas. Tech. | Enzyme Assay and Determination of the Inhibition Constants IC50 |
---|
pH | 7.5±n/a |
---|
Temperature | 295.15±n/a K |
---|
IC50 | >10000±n/a nM |
---|
Citation | Pochetti, G; Montanari, R; Gege, C; Chevrier, C; Taveras, AG; Mazza, F Extra Binding Region Induced by Non-Zinc Chelating Inhibitors into the S(1)' Subsite of Matrix Metalloproteinase 8 (MMP-8) (dagger). J Med Chem52:1040-9 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Matrilysin |
---|
Name: | Matrilysin |
Synonyms: | MMP7 | MMP7_HUMAN | MPSL1 | Matrix metalloproteinase 7 | Matrix metalloproteinase-7 (MMP-7) | Matrix metalloproteinase-7 (MMP7) | PUMP1 |
Type: | Enzyme |
Mol. Mass.: | 29681.54 |
Organism: | Homo sapiens (Human) |
Description: | P09237 |
Residue: | 267 |
Sequence: | MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLK
EMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDL
PHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAF
APGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGD
PQNFKLSQDDIKGIQKLYGKRSNSRKK
|
|
|
BDBM27878 |
---|
OmniMMP Substrate |
---|
Name: | OmniMMP Substrate |
Synonyms: | n/a |
Type: | Peptide |
Mol. Mass.: | 2468.31 |
Organism: | n/a |
Description: | Dpa = 3-(2,4-dinitrophenyl)-L-2,3-diaminopropionyl. It is From Biomol, Hamburg, Germany. |
Residue: | 23 |
Sequence: | MCA-Pro-Leu-Gly-Leu-Dpa-Ala-Arg-NH2
|
|
|