Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKynurenine Aminotransferase 1/Glutamine Transaminase K
LigandBDBM31881
Substrate/CompetitorBDBM31880
Meas. Tech.hKAT-I Activity Assay
pH7.5±n/a
Temperature311.15±n/a K
IC50 220000±220000 nM
Citation Han QRobinson HCai TTagle DALi J Structural insight into the inhibition of human kynurenine aminotransferase I/glutamine transaminase K. J Med Chem 52:2786-93 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Kynurenine Aminotransferase 1/Glutamine Transaminase K
Name:Kynurenine Aminotransferase 1/Glutamine Transaminase K
Synonyms:Cysteine-S-conjugate beta-lyase | Glutamine--phenylpyruvate transaminase | Kynurenine--oxoglutarate transaminase 1
Type:Aminotransferase; Lyase
Mol. Mass.:47874.00
Organism:Homo sapiens (Human)
Description:Recombinant hKAT-1 was expressed and purified from Sf9 insect cells.
Residue:422
Sequence:
MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFML
NQYTKTFGYPPLTKILASFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVII
IEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVL
NTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTL
TIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFR
QPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDE
PYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKV
EL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31881
BDBM31880
NameBDBM31881
Synonyms:DL-indole-3-lactic acid
TypeSmall organic molecule
Emp. Form.C11H11NO3
Mol. Mass.205.2099
SMILESOC(Cc1c[nH]c2ccccc12)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: