| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ |
|---|
| Ligand | BDBM31965 |
|---|
| Substrate/Competitor | BDBM8737 |
|---|
| Meas. Tech. | Enzymatic Inhibition Assay |
|---|
| IC50 | 860±n/a nM |
|---|
| Citation |  He, L; Zhang, L; Liu, X; Li, X; Zheng, M; Li, H; Yu, K; Chen, K; Shen, X; Jiang, H; Liu, H Discovering potent inhibitors against the beta-hydroxyacyl-acyl carrier protein dehydratase (FabZ) of Helicobacter pylori: structure-based design, synthesis, bioassay, and crystal structure determination. J Med Chem52:2465-81 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ |
|---|
| Name: | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ |
|---|
| Synonyms: | (3R)-hydroxymyristoyl ACP dehydrase | (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase | FABZ_HELPY | beta-Hydroxyacyl-Acyl Carrier Protein Dehydratase (FabZ) | fabZ |
|---|
| Type: | Lyase |
|---|
| Mol. Mass.: | 18198.05 |
|---|
| Organism: | Helicobacter pylori (Campylobacter pylori) |
|---|
| Description: | HpfabZ is expressed and purified from E. coli. |
|---|
| Residue: | 159 |
|---|
| Sequence: | MEQSHQNLQSQFFIEHILQILPHRYPMLLVDRIIELQANKKIVAYKNITFNEDVFNGHFP
NKPIFPGVLIVEGMAQTGGFLAFTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLE
YHLEVLKHKGMIWQVGGTAQVDGKVVAEAELKAMIAERD
|
|
|
|---|
| BDBM31965 |
|---|
| BDBM8737 |
|---|
| Name | BDBM31965 |
|---|
| Synonyms: | carbohydrazide derivative, 5h |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H12Br2N2O4 |
|---|
| Mol. Mass. | 480.107 |
|---|
| SMILES | Oc1cc2ccccc2cc1C(=O)NN=Cc1cc(Br)c(O)c(Br)c1O |w:15.17| |
|---|
| Structure | 
|
|---|
Search and Browse
