Reaction Details |
| Report a problem with these data |
Target | Dimer of Gag-Pol polyprotein [489-587,I573V] |
---|
Ligand | BDBM517 |
---|
Substrate/Competitor | HIV-1 Protease substrate |
---|
Meas. Tech. | Protease Inhibition Assay |
---|
pH | 5.5±n/a |
---|
Temperature | 303.15±n/a K |
---|
Ki | 3.107±0.393 nM |
---|
Comments | kcat/Km=3.16/sec/mM |
---|
Citation | Vacca, JP; Dorsey, BD; Schleif, WA; Levin, RB; McDaniel, SL; Darke, PL; Zugay, J; Quintero, JC; Blahy, OM; Roth, E L-735,524: an orally bioavailable human immunodeficiency virus type 1 protease inhibitor. Proc Natl Acad Sci U S A91:4096-100 (1994) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Dimer of Gag-Pol polyprotein [489-587,I573V] |
---|
Name: | Dimer of Gag-Pol polyprotein [489-587,I573V] |
Synonyms: | HIV-1 Protease Mutant (I84V) |
Type: | Protein Complex |
Mol. Mass.: | n/a |
Description: | n/a |
Components: | This complex has 2 components. |
Component 1 |
Name: | Gag-Pol polyprotein [489-587,I573V] |
Synonyms: | HIV-1 Protease Mutant (I84V) chain A | HIV-1 Protease Mutant (I84V) chain B | POL_HV1H2 | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10767.13 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587,I573V] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNVIGRNLLTQIGCTLNF
|
|
|
Component 2 |
Name: | Gag-Pol polyprotein [489-587,I573V] |
Synonyms: | HIV-1 Protease Mutant (I84V) chain A | HIV-1 Protease Mutant (I84V) chain B | POL_HV1H2 | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10767.13 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587,I573V] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNVIGRNLLTQIGCTLNF
|
|
|
BDBM517 |
---|
HIV-1 Protease substrate |
---|
Name: | HIV-1 Protease substrate |
Synonyms: | HIV Protease Peptide Substrate |
Type: | Peptide |
Mol. Mass.: | 4082.51 |
Organism: | n/a |
Description: | n/a |
Residue: | 38 |
Sequence: | Val-Ser-Gln-Asn-beta-naphthylalanine*Pro-Ile-Val
|
|
|