Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHIV-1 Protease Mutant (I84V)
LigandBDBM517
Substrate/CompetitorHIV-1 Protease substrate
Meas. Tech.Protease Inhibition Assay
pH5.5±n/a
Temperature303.15±n/a K
Ki 3.107±0.393 nM
Commentskcat/Km=3.16/sec/mM
Citation Vacca JPDorsey BDSchleif WALevin RBMcDaniel SLDarke PLZugay JQuintero JCBlahy OMRoth E L-735,524: an orally bioavailable human immunodeficiency virus type 1 protease inhibitor. Proc Natl Acad Sci U S A 91:4096-100 (1994) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
HIV-1 Protease Mutant (I84V)
Name:HIV-1 Protease Mutant (I84V)
Synonyms:n/a
Type:Protein Complex
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:HIV-1 Protease Mutant (I84V) chain A
Synonyms:HIV-1 Protease Mutant (I84V) chain B
Type:Enzyme Subunit
Mol. Mass.:10767.13
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNVIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:HIV-1 Protease Mutant (I84V) chain A
Synonyms:HIV-1 Protease Mutant (I84V) chain B
Type:Enzyme Subunit
Mol. Mass.:10767.13
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNVIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM517
HIV-1 Protease substrate
Name:HIV-1 Protease substrate
Synonyms:HIV Protease Peptide Substrate
Type:Peptide
Mol. Mass.:4082.51
Organism:n/a
Description:n/a
Residue:38
Sequence:
Val-Ser-Gln-Asn-beta-naphthylalanine*Pro-Ile-Val