Reaction Details |
| Report a problem with these data |
Target | Ribonuclease H1 |
---|
Ligand | BDBM33417 |
---|
Substrate/Competitor | RNA/DNA hybrid |
---|
Meas. Tech. | Fluorescence-Based RNase H Assay |
---|
pH | 8±n/a |
---|
Temperature | 293.15±n/a K |
---|
IC50 | >100000±n/a nM |
---|
Citation | Kirschberg, TA; Balakrishnan, M; Squires, NH; Barnes, T; Brendza, KM; Chen, X; Eisenberg, EJ; Jin, W; Kutty, N; Leavitt, S; Liclican, A; Liu, Q; Liu, X; Mak, J; Perry, JK; Wang, M; Watkins, WJ; Lansdon, EB RNase H active site inhibitors of human immunodeficiency virus type 1 reverse transcriptase: design, biochemical activity, and structural information. J Med Chem52:5781-4 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Ribonuclease H1 |
---|
Name: | Ribonuclease H1 |
Synonyms: | RNASEH1 | RNH1 | RNH1_HUMAN | RNase H1 | Ribonuclease H type II |
Type: | Enzyme |
Mol. Mass.: | 32076.45 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 286 |
Sequence: | MSWLLFLAHRVALAALPCRRGSRGFGMFYAVRRGRKTGVFLTWNECRAQVDRFPAARFKK
FATEDEAWAFVRKSASPEVSEGHENQHGQESEAKASKRLREPLDGDGHESAEPYAKHMKP
SVEPAPPVSRDTFSYMGDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQ
TNQRAEIHAACKAIEQAKTQNINKLVLYTDSMFTINGITNWVQGWKKNGWKTSAGKEVIN
KEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED
|
|
|
BDBM33417 |
---|
RNA/DNA hybrid |
---|
Name: | RNA/DNA hybrid |
Synonyms: | n/a |
Type: | fluorescein-labeled RNA annealed to DNA |
Mol. Mass.: | 2134.40 |
Organism: | n/a |
Description: | It is a 18-nucleotide 3-fluorescein-labeled RNA annealed to a complementary 18-nucleotide 5-Dabcyl-modified DNA. |
Residue: | 23 |
Sequence: | 5-GAU CUG AGC CUG GGA GCU-fluorescein-3
|
|
|