Reaction Details |
| Report a problem with these data |
Target | Prostaglandin E2 receptor EP3 subtype |
---|
Ligand | BDBM35864 |
---|
Substrate/Competitor | BDBM35847 |
---|
Meas. Tech. | Prostanoid EP Receptor Binding Assay |
---|
Ki | 39±n/a nM |
---|
EC50 | 460±n/a nM |
---|
Citation | Asada, M; Obitsu, T; Nagase, T; Sugimoto, I; Yamaura, Y; Sato, K; Narita, M; Ohuchida, S; Nakai, H; Toda, M Discovery of a series of acrylic acids and their derivatives as chemical leads for selective EP3 receptor antagonists. Bioorg Med Chem17:6567-82 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Prostaglandin E2 receptor EP3 subtype |
---|
Name: | Prostaglandin E2 receptor EP3 subtype |
Synonyms: | PE2R3_MOUSE | PGE receptor, EP3 isoform alpha | Prostaglandin E2 receptor EP3 isoform alpha | Prostaglandin E3 | Prostanoid EP3 receptor | Ptger3 | Ptgerep3 |
Type: | G-protein coupled receptor |
Mol. Mass.: | 40092.50 |
Organism: | Mus musculus (Mouse) |
Description: | n/a |
Residue: | 365 |
Sequence: | MASMWAPEHSAEAHSNLSSTTDDCGSVSVAFPITMMVTGFVGNALAMLLVSRSYRRRESK
RKKSFLLCIGWLALTDLVGQLLTSPVVILVYLSQRRWEQLDPSGRLCTFFGLTMTVFGLS
SLLVASAMAVERALAIRAPHWYASHMKTRATPVLLGVWLSVLAFALLPVLGVGRYSVQWP
GTWCFISTGPAGNETDPAREPGSVAFASAFACLGLLALVVTFACNLATIKALVSRCRAKA
AVSQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLIMMLKMIFNQMSVEQCKTQMGKEKE
CNSFLIAVRLASLNQILDPWVYLLLRKILLRKFCQIRDHTNYASSSTSLPCPGSSALMWS
DQLER
|
|
|
BDBM35864 |
---|
BDBM35847 |
---|
Name | BDBM35864 |
Synonyms: | phenylbutanoic acid analogue, 20 |
Type | Small organic molecule |
Emp. Form. | C26H26N2O3 |
Mol. Mass. | 414.4962 |
SMILES | OC(=O)CCCc1ccc(Cn2cccn2)cc1OCCc1ccc2ccccc2c1 |
Structure |
|