Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase Sgk1
LigandBDBM269143
Substrate/Competitorn/a
Meas. Tech.Enzymatic Activity Assay
pH7.4±n/a
IC50<0.500±n/a nM
Commentsextracted
Citation Nazare MHalland NSchmidt FKleemann HWeiss TSaas JStruebing C N-(4-(azaindazol-6-yl)-phenyl)-sulfonamides and their use as pharmaceuticals US Patent  US9718825 Publication Date 8/1/2017
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase Sgk1
Name:Serine/threonine-protein kinase Sgk1
Synonyms:SGK1 | Serine/threonine-protein kinase Sgk1 | Serine/threonine-protein kinase Sgk1 (SGK) | Serum/glucocorticoid regulated kinase | Serum/glucocorticoid-regulated kinase 1 (SGK1)
Type:Other Protein Type
Mol. Mass.:48954.40
Organism:Homo sapiens (Human)
Description:Recombinant human SGK-1 enzyme produced in a baculovirus system.
Residue:431
Sequence:
MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKI
SQPQEPELMNANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAE
EVFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYIN
GGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTD
FGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSR
NTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINW
DDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLG
FSYAPPTDSFL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM269143
n/a
NameBDBM269143
Synonyms:US9718825, Example 589
TypeSmall organic molecule
Emp. Form.C27H30FN5O3S
Mol. Mass.523.622
SMILESCC(C)N1CC(COc2nc(cc3[nH]nc(C)c23)-c2ccc(NS(=O)(=O)c3cc(C)ccc3F)cc2)C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: