| Reaction Details |
|---|
 | Report a problem with these data |
| Target | C-X-C chemokine receptor type 4 |
|---|
| Ligand | BDBM50244999 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1674396 (CHEMBL4024425) |
|---|
| IC50 | >10000±n/a nM |
|---|
| Citation |  Brancaccio, D; Diana, D; Di Maro, S; Di Leva, FS; Tomassi, S; Fattorusso, R; Russo, L; Scala, S; Trotta, AM; Portella, L; Novellino, E; Marinelli, L; Carotenuto, A Ligand-Based NMR Study of C-X-C Chemokine Receptor Type 4 (CXCR4)-Ligand Interactions on Living Cancer Cells. J Med Chem61:2910-2923 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| C-X-C chemokine receptor type 4 |
|---|
| Name: | C-X-C chemokine receptor type 4 |
|---|
| Synonyms: | C-X-C chemokine receptor type 4 | C-X-C chemokine receptor type 4 (CXCR4) | CD_antigen=CD184 | CXC-R4 | CXCR-4 | CXCR4 | CXCR4_HUMAN | FB22 | Fusin | HM89 | LCR1 | LESTR | Leukocyte-derived seven transmembrane domain receptor | NPYRL | SDF-1 receptor | Stromal cell-derived factor 1 receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 39754.61 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P61073 |
|---|
| Residue: | 352 |
|---|
| Sequence: | MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVI
LVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNL
YSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEA
DDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKT
TVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPI
LYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
|
|
|
|---|
| BDBM50244999 |
|---|
| n/a |
|---|
| Name | BDBM50244999 |
|---|
| Synonyms: | CHEMBL4094209 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C38H54N12O8S2 |
|---|
| Mol. Mass. | 871.041 |
|---|
| SMILES | C[C@H](NC(=O)CCCNC(N)=N)C(=O)N[C@H]1CSSC[C@H](NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](CCCNC(N)=N)NC1=O)C(O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
