| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Free fatty acid receptor 1 |
|---|
| Ligand | BDBM50247164 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1677403 (CHEMBL4027546) |
|---|
| EC50 | 8.0±n/a nM |
|---|
| Citation |  Hamdouchi, C; Maiti, P; Warshawsky, AM; DeBaillie, AC; Otto, KA; Wilbur, KL; Kahl, SD; Patel Lewis, A; Cardona, GR; Zink, RW; Chen, K; Cr, S; Lineswala, JP; Neathery, GL; Bouaichi, C; Diseroad, BA; Campbell, AN; Sweetana, SA; Adams, LA; Cabrera, O; Ma, X; Yumibe, NP; Montrose-Rafizadeh, C; Chen, Y; Miller, AR Discovery of LY3104607: A Potent and Selective G Protein-Coupled Receptor 40 (GPR40) Agonist with Optimized Pharmacokinetic Properties to Support Once Daily Oral Treatment in Patients with Type 2 Diabetes Mellitus. J Med Chem61:934-945 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Free fatty acid receptor 1 |
|---|
| Name: | Free fatty acid receptor 1 |
|---|
| Synonyms: | FFAR1 | FFAR1_HUMAN | G-protein Coupled Receptor 40 | GPR40 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 31473.32 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | O14842 |
|---|
| Residue: | 300 |
|---|
| Sequence: | MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLP
LKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRP
CYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAG
PARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPY
NASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK
|
|
|
|---|
| BDBM50247164 |
|---|
| n/a |
|---|
| Name | BDBM50247164 |
|---|
| Synonyms: | CHEMBL4101901 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H31NO3S |
|---|
| Mol. Mass. | 485.637 |
|---|
| SMILES | CC#C[C@@H](CC(O)=O)c1ccc(OCc2ccc(s2)N2CCC3(CCc4ccccc34)CC2)cc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
