Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 11B1
LigandBDBM50249076
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1679696
IC50 1.1±n/a nM
Citation Hoyt SBTaylor JLondon CAli AUjjainwalla FTata JStruthers MCully DWisniewski TRen NBopp CSok AVerras AMcMasters DChen QTung ETang WSalituro GClemas JZhou GMacNeil DDuffy RXiong Y Discovery of indazole aldosterone synthase (CYP11B2) inhibitors as potential treatments for hypertension. Bioorg Med Chem Lett 27:2384-2388 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 11B1
Name:Cytochrome P450 11B1
Synonyms:CYPXIB1 | Cytochrome P450 11B, mitochondrial precursor | Cytochrome P450 11B1 | Cytochrome P450 11B1 (CYP11B1)
Type:Enzyme
Mol. Mass.:57591.44
Organism:Homo sapiens (Human)
Description:P15538
Residue:503
Sequence:
MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQG
YEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYR
QHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNA
RGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFM
PRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELS
PDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATT
ELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRP
ERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQED
IKMVYSFILRPSMFPLLTFRAIN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50249076
n/a
NameBDBM50249076
Synonyms:CHEMBL4096914
TypeSmall organic molecule
Emp. Form.C15H13ClFN3O
Mol. Mass.305.735
SMILESCC(C)(O)c1cncc(c1)-n1ncc2c(Cl)ccc(F)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: