| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Inward rectifier potassium channel 2 |
|---|
| Ligand | BDBM50249183 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1679758 (CHEMBL4030035) |
|---|
| IC50 | >100000±n/a nM |
|---|
| Citation |  Dong, S; VanGelder, K; Shi, ZC; Yu, Y; Wu, Z; Ferguson, R; Guo, ZZ; Tang, H; Frie, J; Fu, Q; Gu, X; Priest, BT; Thomas-Fowlkes, B; Weinglass, A; Margulis, M; Liu, J; Pai, LY; Hampton, C; Haimbach, RE; Owens, K; Tong, V; Xu, S; Hu, M; Zingaro, GJ; Morissette, P; Ehrhart, J; Roy, S; Sullivan, K; Pasternak, A Improvement of hERG-ROMK index of spirocyclic ROMK inhibitors through scaffold optimization and incorporation of novel pharmacophores. Bioorg Med Chem Lett27:2559-2566 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Inward rectifier potassium channel 2 |
|---|
| Name: | Inward rectifier potassium channel 2 |
|---|
| Synonyms: | Cardiac inward rectifier potassium channel | IRK-1 | IRK1 | Inward rectifier K(+) channel Kir2.1 | KCNJ2 | KCNJ2_HUMAN | Potassium channel, inwardly rectifying subfamily J member 2 | hIRK1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 48281.20 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1515520 |
|---|
| Residue: | 427 |
|---|
| Sequence: | MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFIN
VGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLHGDLDASKEGK
ACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPIAVFMVVFQSIVGCIIDAFIIGAVM
AKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEG
EYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEG
MVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARD
LAEKKYILSNANSFCYENEVALTSKEEDDSENGVPESTSTDTPPDIDLHNQASVPLEPRP
LRRESEI
|
|
|
|---|
| BDBM50249183 |
|---|
| n/a |
|---|
| Name | BDBM50249183 |
|---|
| Synonyms: | CHEMBL4069245 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H28N4O5 |
|---|
| Mol. Mass. | 452.5029 |
|---|
| SMILES | Cc1c2COC(=O)c2ccc1[C@@H](O)CN1CCC2(CCN(C2=O)c2ccc(=O)n(C)n2)CC1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
