| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta |
|---|
| Ligand | BDBM50249986 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_1680835 |
|---|
| Kd | 58±n/a nM |
|---|
| Citation |  Jiang, Y; Zhuang, C; Chen, L; Lu, J; Dong, G; Miao, Z; Zhang, W; Li, J; Sheng, C Structural Biology-Inspired Discovery of Novel KRAS-PDE? Inhibitors. J Med Chem60:9400-9406 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta |
|---|
| Name: | Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta |
|---|
| Synonyms: | 3',5'-cyclic phosphodiesterase | GMP-PDE delta | PDE6D | PDE6D_HUMAN | PDED | Protein p17 | Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 17418.30 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_105761 |
|---|
| Residue: | 150 |
|---|
| Sequence: | MSAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVS
RELNFSSTEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPA
SVLTGNVIIETKFFDDDLLVSTSRVRLFYV
|
|
|
|---|
| BDBM50249986 |
|---|
| n/a |
|---|
| Name | BDBM50249986 |
|---|
| Synonyms: | CHEMBL4073704 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C35H33F2N5O2 |
|---|
| Mol. Mass. | 593.6656 |
|---|
| SMILES | Fc1ccccc1[C@@H]1Nc2ccccc2C(=O)N1CCN1CCC(CC1)N1[C@H](Nc2ccccc2C1=O)c1ccccc1F |r| |
|---|
| Structure | 
|
|---|
Search and Browse
