| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Platelet-activating factor receptor |
|---|
| Ligand | BDBM22876 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_86450 |
|---|
| IC50 | >50000±n/a nM |
|---|
| Citation |  Piwinski, JJ; Wong, JK; Green, MJ; Ganguly, AK; Billah, MM; West, RE; Kreutner, W Dual antagonists of platelet activating factor and histamine. Identification of structural requirements for dual activity of N-Acyl-4-(5,6-dihydro-11H-benzo [5,6]cyclohepta-[1,2-b]pyridin-11-ylidene)piperidines. J Med Chem34:457-61 (1991) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Platelet-activating factor receptor |
|---|
| Name: | Platelet-activating factor receptor |
|---|
| Synonyms: | PAF Platelet activating factor | PAF-R | PAFR | PTAFR | PTAFR_HUMAN | Platelet activating factor receptor | Platelet-activating factor receptor |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 39219.60 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | PAF Platelet activating factor PTAFR HUMAN::P25105 |
|---|
| Residue: | 342 |
|---|
| Sequence: | MEPHDSSHMDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPCKKFNEIKIFMVNLT
MADMLFLITLPLWIVYYQNQGNWILPKFLCNVAGCLFFINTYCSVAFLGVITYNRFQAVT
RPIKTAQANTRKRGISLSLVIWVAIVGAASYFLILDSTNTVPDSAGSGNVTRCFEHYEKG
SVPVLIIHIFIVFSFFLVFLIILFCNLVIIRTLLMQPVQQQRNAEVKRRALWMVCTVLAV
FIICFVPHHVVQLPWTLAELGFQDSKFHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLTEKFYSMRSSRKCSRATTDTVTEVVVPFNQIPGNSLKN
|
|
|
|---|
| BDBM22876 |
|---|
| n/a |
|---|
| Name | BDBM22876 |
|---|
| Synonyms: | CHEMBL998 | Claritin | Loratadine | Sch 29851 | US9138431, LORATADINE (Claritin) | US9333199, LORATADINE (Claritin) | ethyl 4-{13-chloro-4-azatricyclo[9.4.0.0^{3,8}]pentadeca-1(11),3(8),4,6,12,14-hexaen-2-ylidene}piperidine-1-carboxylate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H23ClN2O2 |
|---|
| Mol. Mass. | 382.883 |
|---|
| SMILES | [#6]-[#6]-[#8]-[#6](=O)-[#7]-1-[#6]-[#6]\[#6](-[#6]-[#6]-1)=[#6]-1\c2ccc(Cl)cc2-[#6]-[#6]-c2cccnc-12 |
|---|
| Structure | 
|
|---|
Search and Browse
