| Reaction Details |
|---|
 | Report a problem with these data |
| Target | C-X-C chemokine receptor type 2 |
|---|
| Ligand | BDBM50255541 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1687045 (CHEMBL4037524) |
|---|
| IC50 | 0.501187±n/a nM |
|---|
| Citation |  Lu, H; Yang, T; Xu, Z; Lin, X; Ding, Q; Zhang, Y; Cai, X; Dong, K; Gong, S; Zhang, W; Patel, M; Copley, RCB; Xiang, J; Guan, X; Wren, P; Ren, F Discovery of Novel 1-Cyclopentenyl-3-phenylureas as Selective, Brain Penetrant, and Orally Bioavailable CXCR2 Antagonists. J Med Chem61:2518-2532 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| C-X-C chemokine receptor type 2 |
|---|
| Name: | C-X-C chemokine receptor type 2 |
|---|
| Synonyms: | C-X-C chemokine receptor type 2 (CXCR-2) | C-X-C chemokine receptor type 2 (CXCR2) | CD_antigen=CD182 | CDw128b | CXCR-2 | CXCR2 | CXCR2_HUMAN | Chemokine receptor type 2 (CXCR2) | GRO/MGSA receptor | High affinity interleukin-8 receptor B | IL-8 receptor type 2 | IL-8R B | IL8RB | Interleukin-8 receptor B |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 40767.88 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P25025 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFL
LSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCK
VVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPV
LLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFK
AHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE
ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL
|
|
|
|---|
| BDBM50255541 |
|---|
| n/a |
|---|
| Name | BDBM50255541 |
|---|
| Synonyms: | CHEMBL4088551 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H29ClN2O5S |
|---|
| Mol. Mass. | 456.983 |
|---|
| SMILES | CC1=CCC[C@H]1NC(=O)Nc1ccc(Cl)c(c1O)S(=O)(=O)C(C)(C)C1CCOCC1 |r,t:1| |
|---|
| Structure | 
|
|---|
Search and Browse
