Reaction Details |
| Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Ligand | BDBM50263417 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_1697924 |
---|
Ki | 12±n/a nM |
---|
Citation | Pomplun, S; Sippel, C; Hähle, A; Tay, D; Shima, K; Klages, A; Ünal, CM; Rieß, B; Toh, HT; Hansen, G; Yoon, HS; Bracher, A; Preiser, P; Rupp, J; Steinert, M; Hausch, F Chemogenomic Profiling of Human and Microbial FK506-Binding Proteins. J Med Chem61:3660-3673 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Name: | Peptidyl-prolyl cis-trans isomerase FKBP1A |
Synonyms: | 12 kDa FK506-binding protein | 12 kDa FKBP | FK506-binding protein 1A | FK506-binding protein 1A (FKBP12) | FKB1A_HUMAN | FKBP-12 | FKBP-1A | FKBP1 | FKBP12 | FKBP1A | Immunophilin FKBP12 | PPIase | PPIase FKBP1A | Peptidyl-prolyl cis-trans isomerase (FKBP) | Rotamase | RyR1/FKBP12 | mTOR/FKBP12A/FKBP12B |
Type: | Isomerase |
Mol. Mass.: | 11953.09 |
Organism: | Homo sapiens (Human) |
Description: | P62942 |
Residue: | 108 |
Sequence: | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
|
|
|
BDBM50263417 |
---|
n/a |
---|
Name | BDBM50263417 |
Synonyms: | CHEMBL4068304 |
Type | Small organic molecule |
Emp. Form. | C22H22Cl2FN3O3S |
Mol. Mass. | 498.398 |
SMILES | [H][C@]12CCC[C@]([H])(N1S(=O)(=O)c1cc(Cl)cc(Cl)c1)C(=O)N(Cc1ncccc1F)C[C@@H]2C=C |r,TLB:20:19:7:2.3.4,32:31:7:2.3.4,THB:22:21:7:2.3.4| |
Structure |
|