| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidyl-prolyl cis-trans isomerase FKBP1B |
|---|
| Ligand | BDBM50263407 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_1697925 |
|---|
| Ki | 1.2±n/a nM |
|---|
| Citation |  Pomplun, S; Sippel, C; Hähle, A; Tay, D; Shima, K; Klages, A; Ünal, CM; Rieß, B; Toh, HT; Hansen, G; Yoon, HS; Bracher, A; Preiser, P; Rupp, J; Steinert, M; Hausch, F Chemogenomic Profiling of Human and Microbial FK506-Binding Proteins. J Med Chem61:3660-3673 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptidyl-prolyl cis-trans isomerase FKBP1B |
|---|
| Name: | Peptidyl-prolyl cis-trans isomerase FKBP1B |
|---|
| Synonyms: | 12.6 kDa FKBP | FK506-binding protein 1B | FKB1B_HUMAN | FKBP-12.6 | FKBP-1B | FKBP12.6 | FKBP1B | FKBP1L | FKBP9 | Immunophilin FKBP12.6 | OTK4 | PPIase FKBP1B | Peptidyl-prolyl cis-trans isomerase FKBP1B | Rotamase | h-FKBP-12 | mTOR/FKBP12A/FKBP12B |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 11785.40 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1458980 |
|---|
| Residue: | 108 |
|---|
| Sequence: | MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGF
EEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE
|
|
|
|---|
| BDBM50263407 |
|---|
| n/a |
|---|
| Name | BDBM50263407 |
|---|
| Synonyms: | CHEMBL4090599 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H25Cl2N3O4S |
|---|
| Mol. Mass. | 498.423 |
|---|
| SMILES | [H][C@]12CCC[C@]([H])(N1S(=O)(=O)c1cc(Cl)cc(Cl)c1)C(=O)N(Cc1ccccn1)C[C@@H]2COC |r,TLB:31:30:7:2.3.4,20:19:7:2.3.4,THB:22:21:7:2.3.4| |
|---|
| Structure | 
|
|---|
Search and Browse
