| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melanocortin receptor 5 |
|---|
| Ligand | BDBM50263813 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1698291 (CHEMBL4049181) |
|---|
| IC50 | 6607±n/a nM |
|---|
| Citation |  Durek, T; Cromm, PM; White, AM; Schroeder, CI; Kaas, Q; Weidmann, J; Ahmad Fuaad, A; Cheneval, O; Harvey, PJ; Daly, NL; Zhou, Y; Dellsén, A; Österlund, T; Larsson, N; Knerr, L; Bauer, U; Kessler, H; Cai, M; Hruby, VJ; Plowright, AT; Craik, DJ Development of Novel Melanocortin Receptor Agonists Based on the Cyclic Peptide Framework of Sunflower Trypsin Inhibitor-1. J Med Chem61:3674-3684 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Melanocortin receptor 5 |
|---|
| Name: | Melanocortin receptor 5 |
|---|
| Synonyms: | MC-2 | MC5-R | MC5R | MC5R_HUMAN | Melanocortin MC5 | Melanocortin receptor (M4 and M5) | Melanocortin receptor 5 | Melanocortin receptor 5 (MC5R) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 36612.92 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P33032 |
|---|
| Residue: | 325 |
|---|
| Sequence: | MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDMGIAVEVFLTLGVISLLENILVIGA
IVKNKNLHSPMYFFVCSLAVADMLVSMSSAWETITIYLLNNKHLVIADAFVRHIDNVFDS
MICISVVASMCSLLAIAVDRYVTIFYALRYHHIMTARRSGAIIAGIWAFCTGCGIVFILY
SESTYVILCLISMFFAMLFLLVSLYIHMFLLARTHVKRIAALPGASSARQRTSMQGAVTV
TMLLGVFTVCWAPFFLHLTLMLSCPQNLYCSRFMSHFNMYLILIMCNSVMDPLIYAFRSQ
EMRKTFKEIICCRGFRIACSFPRRD
|
|
|
|---|
| BDBM50263813 |
|---|
| n/a |
|---|
| Name | BDBM50263813 |
|---|
| Synonyms: | CHEMBL4063111 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C77H113N23O16S2 |
|---|
| Mol. Mass. | 1680.996 |
|---|
| SMILES | CC[C@H](C)[C@@H]1NC(=O)[C@@H]2CCCN2C(=O)[C@@H]2CCCN2C(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@@H]2CSSC[C@H](NC1=O)C(=O)N(C)[C@@H](Cc1cnc[nH]1)C(=O)N[C@H](Cc1ccccc1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc1c[nH]c3ccccc13)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N2)[C@H](C)O)[C@@H](C)CC |r| |
|---|
| Structure | 
|
|---|
Search and Browse
