Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCysteinyl leukotriene receptor 1
LigandBDBM50012434
Substrate/Competitorn/a
Meas. Tech.ChEBML_52212
Ki 1500±n/a nM
Citation Youssefyeh RDMagnien ELee TDChan WKLin CJGalemmo RAJohnson WHTan JCampbell HFHuang FC Development of a novel series of (2-quinolinylmethoxy)phenyl-containing compounds as high-affinity leukotriene receptor antagonists. 1. Initial structure-activity relationships. J Med Chem 33:1186-94 (1990) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Cysteinyl leukotriene receptor 1
Name:Cysteinyl leukotriene receptor 1
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:39007.58
Organism:GUINEA PIG
Description:Leukotriene D4 0 GUINEA PIG::Q2NNR5
Residue:340
Sequence:
MDETGNPTIPPASNNTCYDSIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLVKTYHEKSA
FQVYMINLAVADLLCVCTLPLRVAYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAM
SFFRCVAIVFPVQNISLVTQKKARLVCIAIWMFVILTSSPFLMANTYKDEKNNTKCFEPP
QDNQAKNYVLILHYVSLFIGFIIPFITIIVCYTMIIFTLLKSSMKKNLSSRKRAIGMIIV
VTAAFLVSFMPYHIQRTIHLHFLHNKTKPCDSILRMQKSVVITLSLAASNCCFDPLLYFF
SGGNFRRRLSTIRKYSLSSMTYIPKKKTSLPQKGKDICKE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50012434
n/a
NameBDBM50012434
Synonyms:(REV-5,901)1-[3-(Quinolin-2-ylmethoxy)-phenyl]-hexan-1-ol | 1-[3-(Quinolin-2-ylmethoxy)-phenyl]-hexan-1-ol | 1-[3-(Quinolin-2-ylmethoxy)-phenyl]-hexan-1-ol (RG 5901) | 1-[3-(Quinolin-2-ylmethoxy)-phenyl]-hexan-1-ol(REV-5901) | CHEMBL8747 | REV-5901 | REV-901
TypeSmall organic molecule
Emp. Form.C22H25NO2
Mol. Mass.335.4394
SMILESCCCCCC(O)c1cccc(OCc2ccc3ccccc3n2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: