| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cytochrome c oxidase subunit 2 |
|---|
| Ligand | BDBM17636 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1718558 (CHEMBL4133558) |
|---|
| IC50 | >100000±n/a nM |
|---|
| Citation |  Pippione, AC; Giraudo, A; Bonanni, D; Carnovale, IM; Marini, E; Cena, C; Costale, A; Zonari, D; Pors, K; Sadiq, M; Boschi, D; Oliaro-Bosso, S; Lolli, ML Hydroxytriazole derivatives as potent and selective aldo-keto reductase 1C3 (AKR1C3) inhibitors discovered by bioisosteric scaffold hopping approach. Eur J Med Chem139:936-946 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cytochrome c oxidase subunit 2 |
|---|
| Name: | Cytochrome c oxidase subunit 2 |
|---|
| Synonyms: | COII | COX2 | COX2_HUMAN | COXII | MT-CO2 | MTCO2 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 25555.66 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_530099 |
|---|
| Residue: | 227 |
|---|
| Sequence: | MAHAAQVGLQDATSPIMEELITFHDHALMIIFLICFLVLYALFLTLTTKLTNTNISDAQE
METVWTILPAIILVLIALPSLRILYMTDEVNDPSLTIKSIGHQWYWTYEYTDYGGLIFNS
YMLPPLFLEPGDLRLLDVDNRVVLPIEAPIRMMITSQDVLHSWAVPTLGLKTDAIPGRLN
QTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFTL
|
|
|
|---|
| BDBM17636 |
|---|
| n/a |
|---|
| Name | BDBM17636 |
|---|
| Synonyms: | 2-{[3-(trifluoromethyl)phenyl]amino}benzoic acid | Arlef | CHEMBL23588 | Flufenamic acid | Nichisedan | US20240002326, Compound Flufenamic acid | US9271961, Flufenamic Acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H10F3NO2 |
|---|
| Mol. Mass. | 281.2299 |
|---|
| SMILES | OC(=O)c1ccccc1Nc1cccc(c1)C(F)(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
