Reaction Details |
| Report a problem with these data |
Target | Prostaglandin E synthase |
---|
Ligand | BDBM50227631 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1746784 (CHEMBL4181294) |
---|
IC50 | 1360±n/a nM |
---|
Citation | Muthukaman, N; Tambe, M; Deshmukh, S; Pisal, D; Tondlekar, S; Shaikh, M; Sarode, N; Kattige, VG; Pisat, M; Sawant, P; Honnegowda, S; Karande, V; Kulkarni, A; Behera, D; Jadhav, SB; Sangana, RR; Gudi, GS; Khairatkar-Joshi, N; Gharat, LA Discovery of furan and dihydrofuran-fused tricyclic benzo[d]imidazole derivatives as potent and orally efficacious microsomal prostaglandin E synthase-1 (mPGES-1) inhibitors: Part-1. Bioorg Med Chem Lett27:5131-5138 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin E synthase |
---|
Name: | Prostaglandin E synthase |
Synonyms: | MGST1L1 | MPGES1 | PGES | PIG12 | PTGES | PTGES_HUMAN | Prostaglandin E synthase (PGES-1) | Prostaglandin E synthase 1 (mPGES-1) | Prostaglandin E synthase-1 (PGES-1) | Prostaglandin E synthase/G/H synthase 2 | Prostaglandin E2 synthase-1 ( mPGES-1) |
Type: | Protein |
Mol. Mass.: | 17112.22 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 152 |
Sequence: | MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
|
|
|
BDBM50227631 |
---|
n/a |
---|
Name | BDBM50227631 |
Synonyms: | 2-(6-chloro-1H-phenanthro[9,10-d]imidazol-2-yl)isophthalonitrile | CHEMBL412099 |
Type | Small organic molecule |
Emp. Form. | C23H11ClN4 |
Mol. Mass. | 378.813 |
SMILES | Clc1ccc2c3[nH]c(nc3c3ccccc3c2c1)-c1c(cccc1C#N)C#N |
Structure |
|