| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melanocortin receptor 5 |
|---|
| Ligand | BDBM50453139 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1749145 (CHEMBL4183655) |
|---|
| EC50 | 1.9±n/a nM |
|---|
| Citation |  Merlino, F; Zhou, Y; Cai, M; Carotenuto, A; Yousif, AM; Brancaccio, D; Di Maro, S; Zappavigna, S; Limatola, A; Novellino, E; Grieco, P; Hruby, VJ Development of Macrocyclic Peptidomimetics Containing Constrained ?,?-Dialkylated Amino Acids with Potent and Selective Activity at Human Melanocortin Receptors. J Med Chem61:4263-4269 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Melanocortin receptor 5 |
|---|
| Name: | Melanocortin receptor 5 |
|---|
| Synonyms: | MC-2 | MC5-R | MC5R | MC5R_HUMAN | Melanocortin MC5 | Melanocortin receptor (M4 and M5) | Melanocortin receptor 5 | Melanocortin receptor 5 (MC5R) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 36612.92 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P33032 |
|---|
| Residue: | 325 |
|---|
| Sequence: | MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDMGIAVEVFLTLGVISLLENILVIGA
IVKNKNLHSPMYFFVCSLAVADMLVSMSSAWETITIYLLNNKHLVIADAFVRHIDNVFDS
MICISVVASMCSLLAIAVDRYVTIFYALRYHHIMTARRSGAIIAGIWAFCTGCGIVFILY
SESTYVILCLISMFFAMLFLLVSLYIHMFLLARTHVKRIAALPGASSARQRTSMQGAVTV
TMLLGVFTVCWAPFFLHLTLMLSCPQNLYCSRFMSHFNMYLILIMCNSVMDPLIYAFRSQ
EMRKTFKEIICCRGFRIACSFPRRD
|
|
|
|---|
| BDBM50453139 |
|---|
| n/a |
|---|
| Name | BDBM50453139 |
|---|
| Synonyms: | CHEMBL4205548 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C44H57N13O7 |
|---|
| Mol. Mass. | 880.0063 |
|---|
| SMILES | NC(=N)NCCC[C@@H]1NC(=O)[C@@H](Cc2ccccc2)NC(=O)[C@H](Cc2c[nH]cn2)NC(=O)C2(CCCCC2)NC(=O)CC[C@H](NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC1=O)C(N)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
