| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Proteasome subunit beta type-2 |
|---|
| Ligand | BDBM50432548 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1761592 (CHEMBL4196839) |
|---|
| IC50 | >40000±n/a nM |
|---|
| Citation |  Tanaka, M; Zhu, Y; Shionyu, M; Ota, N; Shibata, N; Watanabe, C; Mizusawa, A; Sasaki, R; Mizukami, T; Shiina, I; Hasegawa, M Ridaifen-F conjugated with cell-penetrating peptides inhibits intracellular proteasome activities and induces drug-resistant cell death. Eur J Med Chem146:636-650 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Proteasome subunit beta type-2 |
|---|
| Name: | Proteasome subunit beta type-2 |
|---|
| Synonyms: | 20S proteasome | PSB2_HUMAN | PSMB2 | Proteasome Macropain subunit |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 22837.53 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1294233 |
|---|
| Residue: | 201 |
|---|
| Sequence: | MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYI
QKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDY
LAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSV
RIIDKNGIHDLDNISFPKQGS
|
|
|
|---|
| BDBM50432548 |
|---|
| n/a |
|---|
| Name | BDBM50432548 |
|---|
| Synonyms: | LACTACYSTIN |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H24N2O7S |
|---|
| Mol. Mass. | 376.425 |
|---|
| SMILES | CC(C)[C@H](O)[C@]1(NC(=O)[C@H](C)[C@@H]1O)C(=O)SC[C@H](NC(C)=O)C(O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
