Reaction Details |
| Report a problem with these data |
Target | Elongin-C |
---|
Ligand | BDBM50459954 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1767778 (CHEMBL4219890) |
---|
Kd | 115±n/a nM |
---|
Citation | Soares, P; Gadd, MS; Frost, J; Galdeano, C; Ellis, L; Epemolu, O; Rocha, S; Read, KD; Ciulli, A Group-Based Optimization of Potent and Cell-Active Inhibitors of the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase: Structure-Activity Relationships Leading to the Chemical Probe (2S,4R)-1-((S)-2-(1-Cyanocyclopropanecarboxamido)-3,3-dimethylbutanoyl)-4-hydroxy-N-(4-(4-methylthiazol-5-yl)benzyl)pyrroli J Med Chem61:599-618 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Elongin-C |
---|
Name: | Elongin-C |
Synonyms: | ELOC | ELOC_HUMAN | Elongin 15 kDa subunit | Elongin-C | RNA polymerase II transcription factor SIII subunit C | SIII p15 | TCEB1 | Transcription elongation factor B polypeptide 1 |
Type: | PROTEIN |
Mol. Mass.: | 12466.49 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_108414 |
Residue: | 112 |
Sequence: | MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV
NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
|
|
|
BDBM50459954 |
---|
n/a |
---|
Name | BDBM50459954 |
Synonyms: | CHEMBL4228950 |
Type | Small organic molecule |
Emp. Form. | C28H36N4O5S |
Mol. Mass. | 540.674 |
SMILES | CC(=O)C1(CC1)C(=O)N[C@H](C(=O)N1C[C@H](O)C[C@H]1C(=O)NCc1ccc(cc1)-c1scnc1C)C(C)(C)C |r| |
Structure |
|