| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Elongin-C |
|---|
| Ligand | BDBM50459954 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1767778 (CHEMBL4219890) |
|---|
| Kd | 115±n/a nM |
|---|
| Citation |  Soares, P; Gadd, MS; Frost, J; Galdeano, C; Ellis, L; Epemolu, O; Rocha, S; Read, KD; Ciulli, A Group-Based Optimization of Potent and Cell-Active Inhibitors of the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase: Structure-Activity Relationships Leading to the Chemical Probe (2S,4R)-1-((S)-2-(1-Cyanocyclopropanecarboxamido)-3,3-dimethylbutanoyl)-4-hydroxy-N-(4-(4-methylthiazol-5-yl)benzyl)pyrroli J Med Chem61:599-618 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Elongin-C |
|---|
| Name: | Elongin-C |
|---|
| Synonyms: | ELOC | ELOC_HUMAN | Elongin 15 kDa subunit | Elongin-C | RNA polymerase II transcription factor SIII subunit C | SIII p15 | TCEB1 | Transcription elongation factor B polypeptide 1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 12466.49 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_108414 |
|---|
| Residue: | 112 |
|---|
| Sequence: | MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV
NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
|
|
|
|---|
| BDBM50459954 |
|---|
| n/a |
|---|
| Name | BDBM50459954 |
|---|
| Synonyms: | CHEMBL4228950 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H36N4O5S |
|---|
| Mol. Mass. | 540.674 |
|---|
| SMILES | CC(=O)C1(CC1)C(=O)N[C@H](C(=O)N1C[C@H](O)C[C@H]1C(=O)NCc1ccc(cc1)-c1scnc1C)C(C)(C)C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
