| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E synthase |
|---|
| Ligand | BDBM50460533 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1769747 (CHEMBL4221859) |
|---|
| IC50 | 4.9±n/a nM |
|---|
| Citation |  Muthukaman, N; Deshmukh, S; Tambe, M; Pisal, D; Tondlekar, S; Shaikh, M; Sarode, N; Kattige, VG; Sawant, P; Pisat, M; Karande, V; Honnegowda, S; Kulkarni, A; Behera, D; Jadhav, SB; Sangana, RR; Gudi, GS; Khairatkar-Joshi, N; Gharat, LA Alleviating CYP and hERG liabilities by structure optimization of dihydrofuran-fused tricyclic benzo[d]imidazole series - Potent, selective and orally efficacious microsomal prostaglandin E synthase-1 (mPGES-1) inhibitors: Part-2. Bioorg Med Chem Lett28:1211-1218 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E synthase |
|---|
| Name: | Prostaglandin E synthase |
|---|
| Synonyms: | MGST1L1 | MPGES1 | PGES | PIG12 | PTGES | PTGES_HUMAN | Prostaglandin E synthase (PGES-1) | Prostaglandin E synthase 1 (mPGES-1) | Prostaglandin E synthase-1 (PGES-1) | Prostaglandin E synthase/G/H synthase 2 | Prostaglandin E2 synthase-1 ( mPGES-1) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 17112.22 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 152 |
|---|
| Sequence: | MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
|
|
|
|---|
| BDBM50460533 |
|---|
| n/a |
|---|
| Name | BDBM50460533 |
|---|
| Synonyms: | CHEMBL4225008 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H19Cl2F3N4O2 |
|---|
| Mol. Mass. | 535.345 |
|---|
| SMILES | CC1(C)Cc2c(O1)c(cc1nc(Nc3c(Cl)cccc3Cl)[nH]c21)C(=O)Nc1ccccc1C(F)(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
