| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Ligand | BDBM24777 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1770714 (CHEMBL4222826) |
|---|
| IC50 | 5900±n/a nM |
|---|
| Citation |  Cui, G; Jin, J; Chen, H; Cao, R; Chen, X; Xu, B Synthesis and biological evaluation of pyrimidine derivatives as novel human Pin1 inhibitors. Bioorg Med Chem26:2186-2197 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Name: | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Synonyms: | PIN1 | PIN1_HUMAN | PPIase Pin1 | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 18248.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1502595 |
|---|
| Residue: | 163 |
|---|
| Sequence: | MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
|
|
|
|---|
| BDBM24777 |
|---|
| n/a |
|---|
| Name | BDBM24777 |
|---|
| Synonyms: | 5-hydroxy-1,4-dihydronaphthalene-1,4-dione | 5-hydroxy-1,4-naphthoquinone, 4 | CHEMBL43612 | Juglone | Juglone (6a) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C10H6O3 |
|---|
| Mol. Mass. | 174.1528 |
|---|
| SMILES | Oc1cccc2C(=O)C=CC(=O)c12 |c:8| |
|---|
| Structure | 
|
|---|
Search and Browse
