| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Hematopoietic prostaglandin D synthase |
|---|
| Ligand | BDBM50463722 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1779224 (CHEMBL4236216) |
|---|
| Kd | 0.370000±n/a nM |
|---|
| Citation |  Takaya, D; Inaka, K; Omura, A; Takenuki, K; Kawanishi, M; Yabuki, Y; Nakagawa, Y; Tsuganezawa, K; Ogawa, N; Watanabe, C; Honma, T; Aritake, K; Urade, Y; Shirouzu, M; Tanaka, A Characterization of crystal water molecules in a high-affinity inhibitor and hematopoietic prostaglandin D synthase complex by interaction energy studies. Bioorg Med Chem26:4726-4734 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Hematopoietic prostaglandin D synthase |
|---|
| Name: | Hematopoietic prostaglandin D synthase |
|---|
| Synonyms: | GSTS | Glutathione-dependent PGD synthetase | Glutathione-requiring prostaglandin D synthase | H-PGDS | HPGDS | HPGDS_HUMAN | Hematopoietic prostaglandin D synthase | Hematopoietic prostaglandin D synthase (H-PGDS) | Hematopoietic prostaglandin D synthase (HPGDS) | PGDS | PTGDS2 | Prostaglandin D | Prostaglandin D Synthase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 23341.07 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | The protein was expressed in E. coli strain BL21(DE3) with an N-terminal 6-His tag. |
|---|
| Residue: | 199 |
|---|
| Sequence: | MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLT
LHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELL
TYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKK
VQAIPAVANWIKRRPQTKL
|
|
|
|---|
| BDBM50463722 |
|---|
| n/a |
|---|
| Name | BDBM50463722 |
|---|
| Synonyms: | CHEMBL4238186 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H29N5O4 |
|---|
| Mol. Mass. | 487.5503 |
|---|
| SMILES | O=C(Nc1ccc(cc1)N1CCC(CC1)C(=O)N1CCOCC1)c1cnc(Oc2ccccc2)nc1 |
|---|
| Structure | 
|
|---|
Search and Browse
