| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma intracellular receptor 2 |
|---|
| Ligand | BDBM50083351 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1783007 (CHEMBL4254524) |
|---|
| Ki | 98±n/a nM |
|---|
| Citation |  Temme, L; Frehland, B; Schepmann, D; Robaa, D; Sippl, W; Wünsch, B Hydroxymethyl bioisosteres of phenolic GluN2B-selective NMDA receptor antagonists: Design, synthesis and pharmacological evaluation. Eur J Med Chem144:672-681 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma intracellular receptor 2 |
|---|
| Name: | Sigma intracellular receptor 2 |
|---|
| Synonyms: | S2r | SGMR2_RAT | Sigma intracellular receptor 2 | Sigma-2 receptor | Sigma2 receptor | Tmem97 | Transmembrane protein 97 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 20953.88 |
|---|
| Organism: | Rattus norvegicus (Rat) |
|---|
| Description: | Q5U3Y7 |
|---|
| Residue: | 176 |
|---|
| Sequence: | MGAVTARRCVEWLLGLYFVSHIPITMFIDLQALLPPELYPQEFSNLLRWYSKEFKDPLMQ
EPPVWFKSFLFCELVFQLPFFPIAAYAFFKGSCRWIRIPAIIYAVHTITTLIPILYTILF
EDFSKAIAFKGQRPENFRERLTLVGVYAPYLIIPLILLLFMLRNPYYKFEEKRKKK
|
|
|
|---|
| BDBM50083351 |
|---|
| n/a |
|---|
| Name | BDBM50083351 |
|---|
| Synonyms: | (+/-)-[2-(4-benzylpiperidino)-1-(4-hydroxyphenyl)-1-propanol] | -(2-(4-benzylpiperidin-1-yl)-1-hydroxypropyl)phenol | 4-(2-(4-benzylpiperidin-1-yl)-1-hydroxypropyl)phenol | 4-[2-(4-Benzyl-piperidin-1-yl)-1-hydroxy-propyl]-phenol | CHEMBL305187 | ChEMBL_104385 | IFENPRODIL |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H27NO2 |
|---|
| Mol. Mass. | 325.4446 |
|---|
| SMILES | CC(C(O)c1ccc(O)cc1)N1CCC(Cc2ccccc2)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
