Reaction Details |
| Report a problem with these data |
Target | Similar to alpha-tubulin isoform 1 |
---|
Ligand | BDBM50471748 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_211355 (CHEMBL815871) |
---|
IC50 | >20000±n/a nM |
---|
Citation | Ohsumi, K; Nakagawa, R; Fukuda, Y; Hatanaka, T; Morinaga, Y; Nihei, Y; Ohishi, K; Suga, Y; Akiyama, Y; Tsuji, T Novel combretastatin analogues effective against murine solid tumors: design and structure-activity relationships. J Med Chem41:3022-32 (1998) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Similar to alpha-tubulin isoform 1 |
---|
Name: | Similar to alpha-tubulin isoform 1 |
Synonyms: | Similar to alpha-tubulin isoform 1 |
Type: | PROTEIN |
Mol. Mass.: | 10383.05 |
Organism: | Bos taurus |
Description: | ChEMBL_104716 |
Residue: | 99 |
Sequence: | CVSASPSTLARLVSRSAMPAGSSTAWNTAFSPMARCQVTKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRSSSTLSSSSQAKKMP
|
|
|
BDBM50471748 |
---|
n/a |
---|
Name | BDBM50471748 |
Synonyms: | CHEMBL322173 |
Type | Small organic molecule |
Emp. Form. | C19H18N2O6 |
Mol. Mass. | 370.356 |
SMILES | COc1ccc(\C=C(/C#N)c2cc(OC)c(OC)c(OC)c2)cc1[N+]([O-])=O |
Structure |
|