| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50474150 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_145450 (CHEMBL752039) |
|---|
| Ki | 0.087096±n/a nM |
|---|
| Citation |  Takayama, H; Ishikawa, H; Kurihara, M; Kitajima, M; Aimi, N; Ponglux, D; Koyama, F; Matsumoto, K; Moriyama, T; Yamamoto, LT; Watanabe, K; Murayama, T; Horie, S Studies on the synthesis and opioid agonistic activities of mitragynine-related indole alkaloids: discovery of opioid agonists structurally different from other opioid ligands. J Med Chem45:1949-56 (2002) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50474150 |
|---|
| n/a |
|---|
| Name | BDBM50474150 |
|---|
| Synonyms: | CHEMBL58362 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H30N2O5 |
|---|
| Mol. Mass. | 414.4947 |
|---|
| SMILES | [H][C@@]12C[C@]([H])(C(=C/OC)\C(=O)OC)[C@]([H])(CC)CN1CC[C@]21Nc2cccc(OC)c2C1=O |
|---|
| Structure | 
|
|---|
Search and Browse
