| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Adenylate kinase 2, mitochondrial |
|---|
| Ligand | BDBM50027422 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_32202 (CHEMBL648981) |
|---|
| Ki | 1100000±n/a nM |
|---|
| Citation |  Hampton, A; Patel, AD; Maeda, M; Hai, TT; Chang, CD; Kang, JB; Kappler, F; Abo, M; Preston, RK Use of adenine nucleotide derivatives to assess the potential of exo-active-site-directed reagents as species- or isozyme-specific enzyme inactivators. 3. Synthesis of adenosine 5'-triphosphate derivatives with N6- or 8-substituents bearing iodoacetyl groups. J Med Chem25:373-81 (1982) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Adenylate kinase 2, mitochondrial |
|---|
| Name: | Adenylate kinase 2, mitochondrial |
|---|
| Synonyms: | 2.7.4.3 | AK 2 | ATP-AMP transphosphorylase 2 | ATP:AMP phosphotransferase | Adenylate kinase 2 | Adenylate kinase 2, mitochondrial | Adenylate monophosphate kinase | Ak2 | KAD2_RAT |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 26380.21 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | n/a |
|---|
| Residue: | 239 |
|---|
| Sequence: | MAPNALAPEPEHPEGIRAVLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVASGSEL
GKKLKATMDAGKLVSDEMVVELIEKNLETPSCKNGFLLDGFPRTVKQAEMLDDLMDKRKE
KLDSVIEFSIQDSLLIRRITGRLIHPKSGRSYHEEFNPPKEAMKDDITGEPLIRRSDDNE
KALKTRLEAYHTQTTPLVEYYRKRGIHCAIDASQTPDVVFASILAAFSKATCKDLVMFV
|
|
|
|---|
| BDBM50027422 |
|---|
| n/a |
|---|
| Name | BDBM50027422 |
|---|
| Synonyms: | 1N-{4-[9-(3,4-dihydroxy-5-hydroxymethyltetrahydro-2-furanyl)-9H-6-purinyl(methyl)amino]butyl}-1N-methylacetamide 5'-Triphosphate | CHEMBL2367949 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H31N6O14P3 |
|---|
| Mol. Mass. | 648.3918 |
|---|
| SMILES | CN(CCCCN(C)c1ncnc2n(cnc12)[C@@H]1O[C@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)[C@@H](O)[C@H]1O)C(C)=O |
|---|
| Structure | 
|
|---|
Search and Browse
