| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50027791 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_146973 |
|---|
| IC50 | 9.8±n/a nM |
|---|
| Citation |  Rice, KC; Konicki, PE; Quirion, R; Burke, TR; Pert, CB Synthesis and pharmacological characterization of (+/-)-5,9 alpha-dimethyl-2-[2-(4-fluorophenyl)ethyl]-2'-hydroxy-6,7-benzomorphan (fluorophen), a ligand suitable for visualization of opiate receptors in vivo. J Med Chem26:1643-5 (1983) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50027791 |
|---|
| n/a |
|---|
| Name | BDBM50027791 |
|---|
| Synonyms: | 6,11-Dimethyl-3-phenethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol(phenazocine) | CHEMBL46399 | PHENAZOCINE |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H27NO |
|---|
| Mol. Mass. | 321.4559 |
|---|
| SMILES | CC1C2Cc3ccc(O)cc3C1(C)CCN2CCc1ccccc1 |TLB:16:15:1:4.10.3,9:10:1:15.14.13| |
|---|
| Structure | 
|
|---|
Search and Browse
