| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Similar to alpha-tubulin isoform 1 |
|---|
| Ligand | BDBM50475849 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_367404 (CHEMBL866615) |
|---|
| IC50 | 2200±n/a nM |
|---|
| Citation |  Romagnoli, R; Baraldi, PG; Pavani, MG; Tabrizi, MA; Preti, D; Fruttarolo, F; Piccagli, L; Jung, MK; Hamel, E; Borgatti, M; Gambari, R Synthesis and biological evaluation of 2-amino-3-(3',4',5'-trimethoxybenzoyl)-5-aryl thiophenes as a new class of potent antitubulin agents. J Med Chem49:3906-15 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Similar to alpha-tubulin isoform 1 |
|---|
| Name: | Similar to alpha-tubulin isoform 1 |
|---|
| Synonyms: | Similar to alpha-tubulin isoform 1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 10383.05 |
|---|
| Organism: | Bos taurus |
|---|
| Description: | ChEMBL_104716 |
|---|
| Residue: | 99 |
|---|
| Sequence: | CVSASPSTLARLVSRSAMPAGSSTAWNTAFSPMARCQVTKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRSSSTLSSSSQAKKMP
|
|
|
|---|
| BDBM50475849 |
|---|
| n/a |
|---|
| Name | BDBM50475849 |
|---|
| Synonyms: | CHEMBL212734 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H21NO4S |
|---|
| Mol. Mass. | 383.461 |
|---|
| SMILES | COc1cc(cc(OC)c1OC)C(=O)c1c(N)sc(c1C)-c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
