| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Reverse transcriptase protein |
|---|
| Ligand | BDBM27580 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_756683 (CHEMBL1805148) |
|---|
| IC50 | 300±n/a nM |
|---|
| Citation |  Butini, S; Gemma, S; Brindisi, M; Borrelli, G; Fiorini, I; Samuele, A; Karytinos, A; Facchini, M; Lossani, A; Zanoli, S; Campiani, G; Novellino, E; Focher, F; Maga, G Enantioselective binding of second generation pyrrolobenzoxazepinones to the catalytic ternary complex of HIV-1 RT wild-type and L100I and K103N drug resistant mutants. Bioorg Med Chem Lett21:3935-8 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Reverse transcriptase protein |
|---|
| Name: | Reverse transcriptase protein |
|---|
| Synonyms: | Reverse Transcriptase | Reverse Transcriptase (A62V) | Reverse Transcriptase (F61A) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 30203.56 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | Q9WJQ2 |
|---|
| Residue: | 259 |
|---|
| Sequence: | PISPIEPVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYEHHPDKWT
VQPIVLPEKDSWTVNDIQK
|
|
|
|---|
| BDBM27580 |
|---|
| n/a |
|---|
| Name | BDBM27580 |
|---|
| Synonyms: | 8-[4-(3-chlorophenoxymethyl)phenyl]-8-ethyl-9-oxa-2-azatricyclo[8.4.0.0^{2,6}]tetradeca-1(14),3,5,10,12-pentaen-7-one | Pyrrolobenzoxazepinone (PBO), 5 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H22ClNO3 |
|---|
| Mol. Mass. | 443.921 |
|---|
| SMILES | CCC1(Oc2ccccc2-n2cccc2C1=O)c1ccc(COc2cccc(Cl)c2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
