| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM50484749 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_807276 (CHEMBL1960369) |
|---|
| Ki | 1.9±n/a nM |
|---|
| Citation |  Yan, J; Huang, N; Li, S; Yang, LM; Xing, W; Zheng, YT; Hu, Y Synthesis and biological evaluation of novel amprenavir-based P1-substituted bi-aryl derivatives as ultra-potent HIV-1 protease inhibitors. Bioorg Med Chem Lett22:1976-9 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10904.79 |
|---|
| Organism: | Human immunodeficiency virus 1 (HIV-1) |
|---|
| Description: | Q9YQ12 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50484749 |
|---|
| n/a |
|---|
| Name | BDBM50484749 |
|---|
| Synonyms: | CHEMBL1957069 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C33H40N2O9S |
|---|
| Mol. Mass. | 640.744 |
|---|
| SMILES | COc1ccc(cc1)S(=O)(=O)N(CC(C)C)C[C@@H](O)[C@H](Cc1ccc(cc1)-c1ccc(cc1)C(O)=O)NC(=O)O[C@H]1CCOC1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
