Reaction Details |
| Report a problem with these data |
Target | Protease |
---|
Ligand | BDBM50484749 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_807276 (CHEMBL1960369) |
---|
Ki | 1.9±n/a nM |
---|
Citation | Yan, J; Huang, N; Li, S; Yang, LM; Xing, W; Zheng, YT; Hu, Y Synthesis and biological evaluation of novel amprenavir-based P1-substituted bi-aryl derivatives as ultra-potent HIV-1 protease inhibitors. Bioorg Med Chem Lett22:1976-9 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Protease |
---|
Name: | Protease |
Synonyms: | n/a |
Type: | Enzyme |
Mol. Mass.: | 10904.79 |
Organism: | Human immunodeficiency virus 1 (HIV-1) |
Description: | Q9YQ12 |
Residue: | 99 |
Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50484749 |
---|
n/a |
---|
Name | BDBM50484749 |
Synonyms: | CHEMBL1957069 |
Type | Small organic molecule |
Emp. Form. | C33H40N2O9S |
Mol. Mass. | 640.744 |
SMILES | COc1ccc(cc1)S(=O)(=O)N(CC(C)C)C[C@@H](O)[C@H](Cc1ccc(cc1)-c1ccc(cc1)C(O)=O)NC(=O)O[C@H]1CCOC1 |r| |
Structure |
|