Reaction Details |
| Report a problem with these data |
Target | Reverse transcriptase |
---|
Ligand | BDBM50247434 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_806931 (CHEMBL1959154) |
---|
IC50 | 58000±n/a nM |
---|
Citation | Distinto, S; Esposito, F; Kirchmair, J; Cardia, MC; Gaspari, M; Maccioni, E; Alcaro, S; Markt, P; Wolber, G; Zinzula, L; Tramontano, E Identification of HIV-1 reverse transcriptase dual inhibitors by a combined shape-, 2D-fingerprint- and pharmacophore-based virtual screening approach. Eur J Med Chem50:216-29 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Reverse transcriptase |
---|
Name: | Reverse transcriptase |
Synonyms: | n/a |
Type: | Protein |
Mol. Mass.: | 29598.37 |
Organism: | Human immunodeficiency virus 1 |
Description: | Q9WKE8 |
Residue: | 254 |
Sequence: | PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
|
|
|
BDBM50247434 |
---|
n/a |
---|
Name | BDBM50247434 |
Synonyms: | CHEMBL1958235 |
Type | Small organic molecule |
Emp. Form. | C18H16N2O3S |
Mol. Mass. | 340.396 |
SMILES | Cc1ccc(cc1)S(=O)(=O)N\N=C\c1c(O)ccc2ccccc12 |
Structure |
|