| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Reverse transcriptase |
|---|
| Ligand | BDBM50247434 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_806931 (CHEMBL1959154) |
|---|
| IC50 | 58000±n/a nM |
|---|
| Citation |  Distinto, S; Esposito, F; Kirchmair, J; Cardia, MC; Gaspari, M; Maccioni, E; Alcaro, S; Markt, P; Wolber, G; Zinzula, L; Tramontano, E Identification of HIV-1 reverse transcriptase dual inhibitors by a combined shape-, 2D-fingerprint- and pharmacophore-based virtual screening approach. Eur J Med Chem50:216-29 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Reverse transcriptase |
|---|
| Name: | Reverse transcriptase |
|---|
| Synonyms: | n/a |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 29598.37 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | Q9WKE8 |
|---|
| Residue: | 254 |
|---|
| Sequence: | PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
|
|
|
|---|
| BDBM50247434 |
|---|
| n/a |
|---|
| Name | BDBM50247434 |
|---|
| Synonyms: | CHEMBL1958235 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H16N2O3S |
|---|
| Mol. Mass. | 340.396 |
|---|
| SMILES | Cc1ccc(cc1)S(=O)(=O)N\N=C\c1c(O)ccc2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
