| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Integrase |
|---|
| Ligand | BDBM50029198 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_88620 (CHEMBL701724) |
|---|
| IC50 | 9000±n/a nM |
|---|
| Citation |  Burke, TR; Fesen, MR; Mazumder, A; Wang, J; Carothers, AM; Grunberger, D; Driscoll, J; Kohn, K; Pommier, Y Hydroxylated aromatic inhibitors of HIV-1 integrase. J Med Chem38:4171-8 (1995) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Integrase |
|---|
| Name: | Integrase |
|---|
| Synonyms: | Human immunodeficiency virus type 1 integrase |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 32231.48 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | ChEMBL_90865 |
|---|
| Residue: | 288 |
|---|
| Sequence: | FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED
|
|
|
|---|
| BDBM50029198 |
|---|
| n/a |
|---|
| Name | BDBM50029198 |
|---|
| Synonyms: | (E)-3-(3,4-Dihydroxy-phenyl)-acrylic acid benzyl ester | (E)-benzyl 3-(3,4-dihydroxyphenyl)acrylate | 3-(3,4-Dihydroxy-phenyl)-acrylic acid benzyl ester | CHEMBL133714 | Phenylmethyl 1-(3',4'-dihydroxyphenyl)propenate | benzyl 3-(3,4-dihydroxyphenyl)acrylate | benzyl caffeate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H14O4 |
|---|
| Mol. Mass. | 270.28 |
|---|
| SMILES | Oc1ccc(\C=C\C(=O)OCc2ccccc2)cc1O |
|---|
| Structure | 
|
|---|
Search and Browse
