Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50029782 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_201913 (CHEMBL880938) |
---|
Ki | 9.40±n/a nM |
---|
Citation | Bertha, CM; Vilner, BJ; Mattson, MV; Bowen, WD; Becketts, K; Xu, H; Rothman, RB; Flippen-Anderson, JL; Rice, KC (E)-8-benzylidene derivatives of 2-methyl-5-(3-hydroxyphenyl)morphans: highly selective ligands for the sigma 2 receptor subtype. J Med Chem38:4776-85 (1996) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM50029782 |
---|
n/a |
---|
Name | BDBM50029782 |
Synonyms: | 5-(3-Hydroxy-phenyl)-2-methyl-8-[1-phenyl-meth-(E)-ylidene]-2-aza-bicyclo[3.3.1]nonan-7-one | CHEMBL110319 |
Type | Small organic molecule |
Emp. Form. | C22H23NO2 |
Mol. Mass. | 333.4235 |
SMILES | CN1CCC2(CC1C(=Cc1ccccc1)C(=O)C2)c1cccc(O)c1 |w:8.9| |
Structure |
|