Reaction Details |
| Report a problem with these data |
Target | Cellular retinoic acid-binding protein 1 |
---|
Ligand | BDBM50407395 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_52399 (CHEMBL665903) |
---|
Kd | >200±n/a nM |
---|
Citation | Alam, M; Zhestkov, V; Sani, BP; Venepally, P; Levin, AA; Kazmer, S; Li, E; Norris, AW; Zhang, XK; Lee, MO Conformationally defined 6-s-trans-retinoic acid analogs. 2. Selective agonists for nuclear receptor binding and transcriptional activity. J Med Chem38:2302-10 (1995) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cellular retinoic acid-binding protein 1 |
---|
Name: | Cellular retinoic acid-binding protein 1 |
Synonyms: | Cellular retinoic acid-binding protein I | Crabp1 | RABP1_MOUSE |
Type: | PROTEIN |
Mol. Mass.: | 15588.40 |
Organism: | Mus musculus |
Description: | ChEMBL_52399 |
Residue: | 137 |
Sequence: | MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVR
TTEINFKVGEGFEEETVDGRKCRSLPTWENENKIHCTQTLLEGDGPKTYWTRELANDELI
LTFGADDVVCTRIYVRE
|
|
|
BDBM50407395 |
---|
n/a |
---|
Name | BDBM50407395 |
Synonyms: | CHEMBL2111557 |
Type | Small organic molecule |
Emp. Form. | C23H32O2 |
Mol. Mass. | 340.499 |
SMILES | CCC1=C(C(C)C)\C(CCC1)=C\C(\C)=C/C=C/C=C/C(=C/C)/C(O)=O |c:2| |
Structure |
|