| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50036144 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_159451 (CHEMBL766796) |
|---|
| IC50 | 390±n/a nM |
|---|
| Citation |  Cushman, M; Golebiewski, WM; Pommier, Y; Mazumder, A; Reymen, D; De Clercq, E; Graham, L; Rice, WG Cosalane analogues with enhanced potencies as inhibitors of HIV-1 protease and integrase. J Med Chem38:443-52 (1995) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50036144 |
|---|
| n/a |
|---|
| Name | BDBM50036144 |
|---|
| Synonyms: | 5-{1-(3-carboxy-5-chloro-4-hydroxyphenyl)-5-[7,7-difluoro-9a,11a-dimethyl-(5aR,9aS,11aR)-perhydrocyclopenta[a]phenanthren-1-yl]-1-hexenyl}-3-chloro-2-hydroxybenzoic acid(cosalog-3) | CHEMBL3138268 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C39H46Cl2F2O6 |
|---|
| Mol. Mass. | 719.682 |
|---|
| SMILES | [H][C@@]12[#6]-[#6]-[#6@H](-[#6](-[#6])-[#6]-[#6]\[#6]=[#6](/c3cc(Cl)c(-[#8])c(c3)-[#6](-[#8])=O)-c3cc(Cl)c(-[#8])c(c3)-[#6](-[#8])=O)[C@@]1([#6])[#6]-[#6][C@@]1([H])[C@@]2([H])[#6]-[#6][C@]2([H])[#6]C(F)(F)[#6]-[#6][C@]12[#6] |
|---|
| Structure | 
|
|---|
Search and Browse
