| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50036722 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_201714 |
|---|
| IC50 | 4±n/a nM |
|---|
| Citation |  Schuster, DI; Pan, YP; Singh, G; Stoupakis, G; Cai, B; Lem, G; Ehrlich, GK; Frietze, W; Murphy, RB N-(1-arylpropionyl)-4-aryltetrahydropyridines, a new class of high-affinity selective sigma receptor ligands. J Med Chem36:3923-8 (1994) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25124.85 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99720 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50036722 |
|---|
| n/a |
|---|
| Name | BDBM50036722 |
|---|
| Synonyms: | 3-[4-(4-Fluoro-phenyl)-3,6-dihydro-2H-pyridin-1-yl]-1-phenyl-propan-1-one | CHEMBL338181 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H20FNO |
|---|
| Mol. Mass. | 309.3773 |
|---|
| SMILES | Fc1ccc(cc1)C1=CCN(CCC(=O)c2ccccc2)CC1 |t:8| |
|---|
| Structure | 
|
|---|
Search and Browse
