| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50037537 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_159296 (CHEMBL763336) |
|---|
| IC50 | 0.130000±n/a nM |
|---|
| Citation |  Dorsey, BD; Levin, RB; McDaniel, SL; Vacca, JP; Guare, JP; Darke, PL; Zugay, JA; Emini, EA; Schleif, WA; Quintero, JC L-735,524: the design of a potent and orally bioavailable HIV protease inhibitor. J Med Chem37:3443-51 (1994) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50037537 |
|---|
| n/a |
|---|
| Name | BDBM50037537 |
|---|
| Synonyms: | (S)-1-[(2S,4R)-2-Hydroxy-4-((R)-(R)-2-hydroxy-indan-1-ylcarbamoyl)-5-phenyl-pentyl]-4-(2-oxo-2H-chromene-3-carbonyl)-piperazine-2-carboxylic acid tert-butylamide | CHEMBL333828 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C40H46N4O7 |
|---|
| Mol. Mass. | 694.8158 |
|---|
| SMILES | CC(C)(C)NC(=O)[C@@H]1CN(CCN1C[C@@H](O)C[C@@H](Cc1ccccc1)C(=O)NC1[C@H](O)Cc2ccccc12)C(=O)c1cc2ccccc2oc1=O |
|---|
| Structure | 
|
|---|
Search and Browse
