| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 3',5'-cyclic-AMP phosphodiesterase |
|---|
| Ligand | BDBM50041886 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_157209 (CHEMBL768860) |
|---|
| IC50 | 10±n/a nM |
|---|
| Citation |  Ashton, MJ; Cook, DC; Fenton, G; Karlsson, JA; Palfreyman, MN; Raeburn, D; Ratcliffe, AJ; Souness, JE; Thurairatnam, S; Vicker, N Selective type IV phosphodiesterase inhibitors as antiasthmatic agents. The syntheses and biological activities of 3-(cyclopentyloxy)-4-methoxybenzamides and analogues. J Med Chem37:1696-703 (1994) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 3',5'-cyclic-AMP phosphodiesterase |
|---|
| Name: | 3',5'-cyclic-AMP phosphodiesterase |
|---|
| Synonyms: | Phosphodiesterase 4A |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 13615.65 |
|---|
| Organism: | Sus scrofa |
|---|
| Description: | ChEMBL_155848 |
|---|
| Residue: | 118 |
|---|
| Sequence: | PWLVGWWDQFKRMLNRELTHLSEMSRSGNQVSEYISTTFLDKQNEVDIPSPTMKDHEKQQ
APRQRPSQQPPPPGPQFQPMSQITGVKKLMHSSSLNEDSSIPRFGVKTDQEELLAQEL
|
|
|
|---|
| BDBM50041886 |
|---|
| n/a |
|---|
| Name | BDBM50041886 |
|---|
| Synonyms: | 3-(Bicyclo[2.2.1]hept-2-yloxy)-N-(2,6-dichloro-phenyl)-4-methoxy-benzamide | CHEMBL300290 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H21Cl2NO3 |
|---|
| Mol. Mass. | 406.302 |
|---|
| SMILES | COc1ccc(cc1OC1CC2CCC1C2)C(=O)Nc1c(Cl)cccc1Cl |TLB:8:9:15:13.12| |
|---|
| Structure | 
|
|---|
Search and Browse
