Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50043398 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_54605 (CHEMBL667327) |
---|
Ki | 0.0052±n/a nM |
---|
Citation | Piper, JR; Johnson, CA; Maddry, JA; Malik, ND; McGuire, JJ; Otter, GM; Sirotnak, FM Studies on analogues of classical antifolates bearing the naphthoyl group in place of benzoyl in the side chain. J Med Chem36:4161-71 (1994) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_MOUSE | Dhfr |
Type: | Enzyme |
Mol. Mass.: | 21608.82 |
Organism: | Mus musculus (Mouse) |
Description: | n/a |
Residue: | 187 |
Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQPELASKVDMVWIVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKF
EVYEKKD
|
|
|
BDBM50043398 |
---|
n/a |
---|
Name | BDBM50043398 |
Synonyms: | 2-({4-[(2,4-Diamino-quinazolin-6-ylmethyl)-amino]-naphthalene-1-carbonyl}-amino)-pentanedioic acid | CHEMBL134817 |
Type | Small organic molecule |
Emp. Form. | C25H24N6O5 |
Mol. Mass. | 488.4953 |
SMILES | Nc1nc(N)c2cc(CNc3ccc(C(=O)NC(CCC(O)=O)C(O)=O)c4ccccc34)ccc2n1 |
Structure |
|